PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C022205P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family M-type_MADS
Protein Properties Length: 113aa    MW: 12803 Da    PI: 10.4328
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C022205P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF80.89e-26958150
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                    krien   rqvtf+kRr+g+lKKA+ELSvLCdae+ + ifs +gklye +
  MELO3C022205P1  9 KRIENPVHRQVTFCKRRAGLLKKAKELSVLCDAEIGLFIFSAHGKLYELA 58
                    79*********************************************965 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.9E-35160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.18E-28176IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.787161IPR002100Transcription factor, MADS-box
CDDcd002651.50E-40276No hitNo description
PRINTSPR004041.3E-27323IPR002100Transcription factor, MADS-box
PfamPF003198.2E-231056IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-273859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0048364Biological Processroot development
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 113 aa     Download sequence    Send to blast
MARGKVQMKR IENPVHRQVT FCKRRAGLLK KAKELSVLCD AEIGLFIFSA HGKLYELATK  60
GTMQGLIERY MKHTNGNQPP DPPIHHQTSE AKEEIIRLKQ EIEVLKGLRL NT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A2e-18391286Myocyte-specific enhancer factor 2A
3kov_B2e-18391286Myocyte-specific enhancer factor 2A
3kov_I2e-18391286Myocyte-specific enhancer factor 2A
3kov_J2e-18391286Myocyte-specific enhancer factor 2A
3p57_A2e-18391286Myocyte-specific enhancer factor 2A
3p57_B2e-18391286Myocyte-specific enhancer factor 2A
3p57_C2e-18391286Myocyte-specific enhancer factor 2A
3p57_D2e-18391286Myocyte-specific enhancer factor 2A
3p57_I2e-18391286Myocyte-specific enhancer factor 2A
3p57_J2e-18391286Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818898e-97LN681889.1 Cucumis melo genomic scaffold, anchoredscaffold00051.
GenBankLN7132638e-97LN713263.1 Cucumis melo genomic chromosome, chr_9.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008459723.11e-75PREDICTED: agamous-like MADS-box protein AGL12
SwissprotQ388411e-44AGL12_ARATH; Agamous-like MADS-box protein AGL12
TrEMBLA0A0A0KW771e-73A0A0A0KW77_CUCSA; Uncharacterized protein
STRINGGLYMA12G00770.14e-55(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF75663144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71692.17e-46AGAMOUS-like 12